PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.YL288
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 282aa    MW: 31900 Da    PI: 9.2934
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.YL288genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.24.9e-51521761128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+evdi+k++PwdLp      e+e yfFs+r+ ky++g+r+nrat+sgyWkatg dk++ ++ ++
  Araip.YL288  52 LPPGFRFHPTDEELVVQYLKRKVFSCPLPA-SFIPEVDICKSDPWDLPGD---LEQERYFFSTREAKYPNGNRSNRATNSGYWKATGLDKHIATSkGH 145
                  79****************************.89***************54...46799**********************************998567 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  +l+g+kktLvfy+g+ p g++tdW+mheyrl
  Araip.YL288 146 QLIGMKKTLVFYRGKPPYGSRTDWIMHEYRL 176
                  77***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.29E-6048196IPR003441NAC domain
PROSITE profilePS5100557.89252196IPR003441NAC domain
PfamPF023651.8E-2753176IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
EAARVPSVSS LFVTQADKHK YIVLPLTIVG SIEQKRMEGR GSSFVKNGEL RLPPGFRFHP  60
TDEELVVQYL KRKVFSCPLP ASFIPEVDIC KSDPWDLPGD LEQERYFFST REAKYPNGNR  120
SNRATNSGYW KATGLDKHIA TSKGHQLIGM KKTLVFYRGK PPYGSRTDWI MHEYRLVSHP  180
HLLPMQNWVL CRIFFKRRAP ATAKNVLLDH NSHSASASEE AFTISHEGSN SKVVFYDFLA  240
QNRADLNRVT PPASSTSGTS GITTESDEHE DSSSCNNFPF FR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-504919714166NO APICAL MERISTEM PROTEIN
1ut4_B2e-504919714166NO APICAL MERISTEM PROTEIN
1ut7_A2e-504919714166NO APICAL MERISTEM PROTEIN
1ut7_B2e-504919714166NO APICAL MERISTEM PROTEIN
3swm_A2e-504919717169NAC domain-containing protein 19
3swm_B2e-504919717169NAC domain-containing protein 19
3swm_C2e-504919717169NAC domain-containing protein 19
3swm_D2e-504919717169NAC domain-containing protein 19
3swp_A2e-504919717169NAC domain-containing protein 19
3swp_B2e-504919717169NAC domain-containing protein 19
3swp_C2e-504919717169NAC domain-containing protein 19
3swp_D2e-504919717169NAC domain-containing protein 19
4dul_A2e-504919714166NAC domain-containing protein 19
4dul_B2e-504919714166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016194832.10.0PREDICTED: NAC domain-containing protein 83-like
SwissprotQ9FY931e-101NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0M4FP121e-118A0A0M4FP12_MANES; NAC transcription factors 34
STRINGGLYMA18G53954.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.17e-94NAC domain containing protein 83